Anti-PIAS4

Catalog Number: ATA-HPA076008
Article Name: Anti-PIAS4
Biozol Catalog Number: ATA-HPA076008
Supplier Catalog Number: HPA076008
Alternative Catalog Number: ATA-HPA076008-100,ATA-HPA076008-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ12419, Piasg, PIASY, ZMIZ6
Clonality: Polyclonal
Isotype: IgG
NCBI: 51588
UniProt: Q8N2W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGA
Target: PIAS4
Antibody Type: Monoclonal Antibody
HPA076008-100ul