Anti-IRF5

Catalog Number: ATA-HPA076024
Article Name: Anti-IRF5
Biozol Catalog Number: ATA-HPA076024
Supplier Catalog Number: HPA076024
Alternative Catalog Number: ATA-HPA076024-100,ATA-HPA076024-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 3663
UniProt: Q13568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKE
Target: IRF5
Antibody Type: Monoclonal Antibody
HPA076024-100ul