Anti-MRPL46
Catalog Number:
ATA-HPA076046
| Article Name: |
Anti-MRPL46 |
| Biozol Catalog Number: |
ATA-HPA076046 |
| Supplier Catalog Number: |
HPA076046 |
| Alternative Catalog Number: |
ATA-HPA076046-100,ATA-HPA076046-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
C15orf4, LIECG2, P2ECSL |
| Clonality: |
Polyclonal |
| Concentration: |
0,7 |
| NCBI: |
26589 |
| UniProt: |
Q9H2W6 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
AAPSSNGSPWRLLGALCLQRPPVVSKPLTPLQEEMASLLQQIEIERSLYSDHELRALDENQRLAKKKADLHDEEDEQDILL |
| Target: |
MRPL46 |
![]()
|
HPA076046-100ul |
