Anti-ZC3H7B

Catalog Number: ATA-HPA076092
Article Name: Anti-ZC3H7B
Biozol Catalog Number: ATA-HPA076092
Supplier Catalog Number: HPA076092
Alternative Catalog Number: ATA-HPA076092-100,ATA-HPA076092-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp434K0920, FLJ13787, KIAA1031, RoXaN
Clonality: Polyclonal
Isotype: IgG
NCBI: 23264
UniProt: Q9UGR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TFSLLSNGTAAGVADQGTSNGLGSIDDIETDCYVDPRGSPALLPSTPTMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDG
Target: ZC3H7B
Antibody Type: Monoclonal Antibody
HPA076092-100ul