Anti-PCDHGC5

Catalog Number: ATA-HPA076140
Article Name: Anti-PCDHGC5
Biozol Catalog Number: ATA-HPA076140
Supplier Catalog Number: HPA076140
Alternative Catalog Number: ATA-HPA076140-100,ATA-HPA076140-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PCDH-GAMMA-C5
Clonality: Polyclonal
Isotype: IgG
NCBI: 56097
UniProt: Q9Y5F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QLDYSFGDHTSEAVRNLFGLDPSSGAIHVLGPIDFEESRFYEIHARARDQGQPAMEGHCVIQVDVG
Target: PCDHGC5
Antibody Type: Monoclonal Antibody
HPA076140-100ul