Anti-ARHGAP36

Catalog Number: ATA-HPA076209
Article Name: Anti-ARHGAP36
Biozol Catalog Number: ATA-HPA076209
Supplier Catalog Number: HPA076209
Alternative Catalog Number: ATA-HPA076209-100,ATA-HPA076209-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ30058
Clonality: Polyclonal
Isotype: IgG
NCBI: 158763
UniProt: Q6ZRI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TAYHELVARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRR
Target: ARHGAP36
Antibody Type: Monoclonal Antibody
HPA076209-100ul