Anti-DOHH

Catalog Number: ATA-HPA076271
Article Name: Anti-DOHH
Biozol Catalog Number: ATA-HPA076271
Supplier Catalog Number: HPA076271
Alternative Catalog Number: ATA-HPA076271-100,ATA-HPA076271-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HLRC1, MGC4293
Clonality: Polyclonal
Isotype: IgG
NCBI: 83475
UniProt: Q9BU89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TENPMVRHECAEALGAIAQPACLAALQAHADDPERVVRESCEVALDMYEHETG
Target: DOHH
Antibody Type: Monoclonal Antibody
HPA076271-100ul