Anti-ASCL1

Catalog Number: ATA-HPA076307
Article Name: Anti-ASCL1
Biozol Catalog Number: ATA-HPA076307
Supplier Catalog Number: HPA076307
Alternative Catalog Number: ATA-HPA076307-100,ATA-HPA076307-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ASH1, bHLHa46, HASH1
Clonality: Polyclonal
Isotype: IgG
NCBI: 429
UniProt: P50553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL
Target: ASCL1
Antibody Type: Monoclonal Antibody
HPA076307-100ul