Anti-MOGAT1

Catalog Number: ATA-HPA076308
Article Name: Anti-MOGAT1
Biozol Catalog Number: ATA-HPA076308
Supplier Catalog Number: HPA076308
Alternative Catalog Number: ATA-HPA076308-100,ATA-HPA076308-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DGAT2L, DGAT2L1, MGAT1
Clonality: Polyclonal
Concentration: 0,1
NCBI: 116255
UniProt: Q96PD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS
Target: MOGAT1
HPA076308-100ul