Anti-KIAA0319, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-KIAA0319, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA076313
• Supplier Catalog Number: HPA076313
• Alternative Catalog Number: ATA-HPA076313-100,ATA-HPA076313-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: NMIG

Product Description

KIAA0319

Additional Information

Anti-KIAA0319

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 9856
• UniProt: Q5VV43
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KTKYTILDNMDEQERMELRPKYGIKHRSTEHNSSLMVSESEFDSDQDTIFSREKMERGNPKVSMNGSIRNGASFSYCSKD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml

Images

Immunofluorescent staining of human cell line HeLa shows localization to vesicles.