Anti-OTUD7B

Catalog Number: ATA-HPA076357
Article Name: Anti-OTUD7B
Biozol Catalog Number: ATA-HPA076357
Supplier Catalog Number: HPA076357
Alternative Catalog Number: ATA-HPA076357-100,ATA-HPA076357-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CEZANNE, ZA20D1
Clonality: Polyclonal
Isotype: IgG
NCBI: 56957
UniProt: Q6GQQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDA
Target: OTUD7B
Antibody Type: Monoclonal Antibody
HPA076357-100ul