Anti-HDAC5

Catalog Number: ATA-HPA076420
Article Name: Anti-HDAC5
Biozol Catalog Number: ATA-HPA076420
Supplier Catalog Number: HPA076420
Alternative Catalog Number: ATA-HPA076420-100,ATA-HPA076420-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ90614, KIAA0600, NY-CO-9
Clonality: Polyclonal
Concentration: 0,2
NCBI: 10014
UniProt: Q9UQL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPL
Target: HDAC5
HPA076420-100ul