Anti-CDH8

Catalog Number: ATA-HPA076441
Article Name: Anti-CDH8
Biozol Catalog Number: ATA-HPA076441
Supplier Catalog Number: HPA076441
Alternative Catalog Number: ATA-HPA076441-100,ATA-HPA076441-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 1006
UniProt: P55286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIII
Target: CDH8
Antibody Type: Monoclonal Antibody
HPA076441-100ul