Anti-MAGEB16

Catalog Number: ATA-HPA076456
Article Name: Anti-MAGEB16
Biozol Catalog Number: ATA-HPA076456
Supplier Catalog Number: HPA076456
Alternative Catalog Number: ATA-HPA076456-100,ATA-HPA076456-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 139604
UniProt: A2A368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SEDTSDPRNVPADALDQKVAFLVNFMLHKCQMK
Target: MAGEB16
Antibody Type: Monoclonal Antibody
HPA076456-100ul