Anti-KCNA6

Catalog Number: ATA-HPA076475
Article Name: Anti-KCNA6
Biozol Catalog Number: ATA-HPA076475
Supplier Catalog Number: HPA076475
Alternative Catalog Number: ATA-HPA076475-100,ATA-HPA076475-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HBK2, Kv1.6, PPP1R96
Clonality: Polyclonal
Concentration: 0,4
NCBI: 3742
UniProt: P17658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE
Target: KCNA6
HPA076475-100ul