Anti-MXRA5

Catalog Number: ATA-HPA076518
Article Name: Anti-MXRA5
Biozol Catalog Number: ATA-HPA076518
Supplier Catalog Number: HPA076518
Alternative Catalog Number: ATA-HPA076518-100,ATA-HPA076518-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp564I1922
Clonality: Polyclonal
Isotype: IgG
NCBI: 25878
UniProt: Q9NR99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LMLSKDPRVSYQYRQDADEEALYYTGVRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSYYTQYSQTISTKDTRQARGRSWVMIEPSGAVQRDQTVLEG
Target: MXRA5
Antibody Type: Monoclonal Antibody
HPA076518-100ul