Anti-CHRDL2

Catalog Number: ATA-HPA076522
Article Name: Anti-CHRDL2
Biozol Catalog Number: ATA-HPA076522
Supplier Catalog Number: HPA076522
Alternative Catalog Number: ATA-HPA076522-100,ATA-HPA076522-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BNF1
Clonality: Polyclonal
Isotype: IgG
NCBI: 25884
UniProt: Q6WN34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPK
Target: CHRDL2
Antibody Type: Monoclonal Antibody
HPA076522-100ul