Anti-PHF1

Catalog Number: ATA-HPA076579
Article Name: Anti-PHF1
Biozol Catalog Number: ATA-HPA076579
Supplier Catalog Number: HPA076579
Alternative Catalog Number: ATA-HPA076579-100,ATA-HPA076579-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MTF2L2, PCL1, TDRD19C
Clonality: Polyclonal
Concentration: 0,1
NCBI: 5252
UniProt: O43189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWV
Target: PHF1
HPA076579-100ul