Anti-CENPJ

Catalog Number: ATA-HPA076638
Article Name: Anti-CENPJ
Biozol Catalog Number: ATA-HPA076638
Supplier Catalog Number: HPA076638
Alternative Catalog Number: ATA-HPA076638-100,ATA-HPA076638-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4
Clonality: Polyclonal
Concentration: 0,1
NCBI: 55835
UniProt: Q9HC77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIG
Target: CENPJ
HPA076638-100ul