Anti-DUSP15

Catalog Number: ATA-HPA076649
Article Name: Anti-DUSP15
Biozol Catalog Number: ATA-HPA076649
Supplier Catalog Number: HPA076649
Alternative Catalog Number: ATA-HPA076649-100,ATA-HPA076649-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA243J16.5, bA243J16.6, C20orf57, FLJ20645, VHY
dual specificity phosphatase 15
Anti-DUSP15
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 128853
UniProt: Q9H1R2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DUSP15
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-DUSP15 antibody. Corresponding DUSP15 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA076649-100ul
HPA076649-100ul
HPA076649-100ul