Anti-SYPL2

Catalog Number: ATA-HPA076657
Article Name: Anti-SYPL2
Biozol Catalog Number: ATA-HPA076657
Supplier Catalog Number: HPA076657
Alternative Catalog Number: ATA-HPA076657-100,ATA-HPA076657-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Mg29
Clonality: Polyclonal
Isotype: IgG
NCBI: 284612
UniProt: Q5VXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVE
Target: SYPL2
Antibody Type: Monoclonal Antibody
HPA076657-100ul