Anti-UNC5B

Catalog Number: ATA-HPA076687
Article Name: Anti-UNC5B
Biozol Catalog Number: ATA-HPA076687
Supplier Catalog Number: HPA076687
Alternative Catalog Number: ATA-HPA076687-100,ATA-HPA076687-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: p53RDL1, UNC5H2
Clonality: Polyclonal
Isotype: IgG
NCBI: 219699
UniProt: Q8IZJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE
Target: UNC5B
Antibody Type: Monoclonal Antibody
HPA076687-100ul