Anti-RPL34

Catalog Number: ATA-HPA076722
Article Name: Anti-RPL34
Biozol Catalog Number: ATA-HPA076722
Supplier Catalog Number: HPA076722
Alternative Catalog Number: ATA-HPA076722-100,ATA-HPA076722-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: L34
Clonality: Polyclonal
Concentration: 0,1
NCBI: 6164
UniProt: P49207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKC
Target: RPL34
HPA076722-100ul