Anti-CASKIN1

Catalog Number: ATA-HPA076882
Article Name: Anti-CASKIN1
Biozol Catalog Number: ATA-HPA076882
Supplier Catalog Number: HPA076882
Alternative Catalog Number: ATA-HPA076882-100,ATA-HPA076882-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ANKS5A, KIAA1306
Clonality: Polyclonal
Isotype: IgG
NCBI: 57524
UniProt: Q8WXD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVKHKEAIGPGGEVVNRRRTLSGPVTGLLATARRGPGESADPGPFVEDGTGRQRPRGPSK
Target: CASKIN1
Antibody Type: Monoclonal Antibody
HPA076882-100ul