Anti-PHLPP1

Catalog Number: ATA-HPA076883
Article Name: Anti-PHLPP1
Biozol Catalog Number: ATA-HPA076883
Supplier Catalog Number: HPA076883
Alternative Catalog Number: ATA-HPA076883-100,ATA-HPA076883-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: KIAA0606, PHLPP, PLEKHE1, SCOP
Rabbit Polyclonal PHLPP1 Antibody against Human PH domain and leucine rich repeat protein phosphatase 1. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.5
NCBI: 23239
UniProt: O60346
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: HCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGG
WB Image Caption 1