Anti-ZNF112

Catalog Number: ATA-HPA076887
Article Name: Anti-ZNF112
Biozol Catalog Number: ATA-HPA076887
Supplier Catalog Number: HPA076887
Alternative Catalog Number: ATA-HPA076887-100,ATA-HPA076887-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZFP112, ZNF228
Clonality: Polyclonal
Concentration: 0,3
NCBI: 7771
UniProt: Q9UJU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVSWLSHHNDKLEVHRKENYSCHDCGEDIMKVSLLNQESIQTEEKPYPCTGYRKAFSNDSSSEVHQQFHLEGKPYTYSSCGKGC
Target: ZNF112
HPA076887-100ul