Anti-STAC2

Catalog Number: ATA-HPA076925
Article Name: Anti-STAC2
Biozol Catalog Number: ATA-HPA076925
Supplier Catalog Number: HPA076925
Alternative Catalog Number: ATA-HPA076925-100,ATA-HPA076925-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 24b2
Clonality: Polyclonal
Isotype: IgG
NCBI: 342667
UniProt: Q6ZMT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEP
Target: STAC2
Antibody Type: Monoclonal Antibody
HPA076925-100ul