Anti-ZUP1

Catalog Number: ATA-HPA076940
Article Name: Anti-ZUP1
Biozol Catalog Number: ATA-HPA076940
Supplier Catalog Number: HPA076940
Alternative Catalog Number: ATA-HPA076940-100,ATA-HPA076940-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6orf113, dJ412I7.3, ZUFSP
Clonality: Polyclonal
Concentration: 0,2
NCBI: 221302
UniProt: Q96AP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA
Target: ZUP1
HPA076940-100ul