Anti-MOAP1

Catalog Number: ATA-HPA076948
Article Name: Anti-MOAP1
Biozol Catalog Number: ATA-HPA076948
Supplier Catalog Number: HPA076948
Alternative Catalog Number: ATA-HPA076948-100,ATA-HPA076948-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MAP-1, PNMA4
Clonality: Polyclonal
Isotype: IgG
NCBI: 64112
UniProt: Q96BY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF
Target: MOAP1
Antibody Type: Monoclonal Antibody
HPA076948-100ul