Anti-FKBP6

Catalog Number: ATA-HPA077010
Article Name: Anti-FKBP6
Biozol Catalog Number: ATA-HPA077010
Supplier Catalog Number: HPA077010
Alternative Catalog Number: ATA-HPA077010-100,ATA-HPA077010-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FKBP36, PPIase
Clonality: Polyclonal
Concentration: 0,05
NCBI: 8468
UniProt: O75344
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLAS
Target: FKBP6
HPA077010-100ul