Anti-MFGE8

Catalog Number: ATA-HPA077076
Article Name: Anti-MFGE8
Biozol Catalog Number: ATA-HPA077076
Supplier Catalog Number: HPA077076
Alternative Catalog Number: ATA-HPA077076-100,ATA-HPA077076-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Alternative Names: BA46, EDIL1, hP47, HsT19888, MFG-E8, OAcGD3S, SED1, SPAG10
Rabbit Polyclonal MFGE8 Antibody against Human milk fat globule EGF and factor V/VIII domain containing. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.1
NCBI: 4240
UniProt: Q08431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: RRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHT
WB Image Caption 1