Anti-MFGE8
Catalog Number:
ATA-HPA077076
| Article Name: |
Anti-MFGE8 |
| Biozol Catalog Number: |
ATA-HPA077076 |
| Supplier Catalog Number: |
HPA077076 |
| Alternative Catalog Number: |
ATA-HPA077076-100,ATA-HPA077076-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
BA46, EDIL1, hP47, HsT19888, MFG-E8, OAcGD3S, SED1, SPAG10 |
| Rabbit Polyclonal MFGE8 Antibody against Human milk fat globule EGF and factor V/VIII domain containing. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
4240 |
| UniProt: |
Q08431 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
RRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHT |
|
WB Image Caption 1 |