Anti-THAP12

Catalog Number: ATA-HPA077077
Article Name: Anti-THAP12
Biozol Catalog Number: ATA-HPA077077
Supplier Catalog Number: HPA077077
Alternative Catalog Number: ATA-HPA077077-100,ATA-HPA077077-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DAP4, P52rIPK, PRKRIR, THAP0
Clonality: Polyclonal
Concentration: 0,1
NCBI: 5612
UniProt: O43422
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLC
Target: THAP12
HPA077077-100ul