Anti-LOXHD1

Catalog Number: ATA-HPA077128
Article Name: Anti-LOXHD1
Biozol Catalog Number: ATA-HPA077128
Supplier Catalog Number: HPA077128
Alternative Catalog Number: ATA-HPA077128-100,ATA-HPA077128-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DFNB77, FLJ32670, LH2D1
Clonality: Polyclonal
Isotype: IgG
NCBI: 125336
UniProt: Q8IVV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV
Target: LOXHD1
Antibody Type: Monoclonal Antibody
HPA077128-100ul