Anti-GAL3ST1

Catalog Number: ATA-HPA077138
Article Name: Anti-GAL3ST1
Biozol Catalog Number: ATA-HPA077138
Supplier Catalog Number: HPA077138
Alternative Catalog Number: ATA-HPA077138-100,ATA-HPA077138-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CST
Clonality: Polyclonal
Isotype: IgG
NCBI: 9514
UniProt: Q99999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGHAVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLM
Target: GAL3ST1
Antibody Type: Monoclonal Antibody
HPA077138-100ul