Anti-WSB2
Catalog Number:
ATA-HPA077139
| Article Name: |
Anti-WSB2 |
| Biozol Catalog Number: |
ATA-HPA077139 |
| Supplier Catalog Number: |
HPA077139 |
| Alternative Catalog Number: |
ATA-HPA077139-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
MGC10210, SBA2 |
| Rabbit Polyclonal WSB2 Antibody against Human WD repeat and SOCS box containing 2. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
55884 |
| UniProt: |
Q9NYS7 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
ALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMK |
![]()
|
WB Image Caption 1 |
