Anti-TMEM168

Catalog Number: ATA-HPA077143
Article Name: Anti-TMEM168
Biozol Catalog Number: ATA-HPA077143
Supplier Catalog Number: HPA077143
Alternative Catalog Number: ATA-HPA077143-100,ATA-HPA077143-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp564C012, FLJ13576
Clonality: Polyclonal
Isotype: IgG
NCBI: 64418
UniProt: Q9H0V1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWRE
Target: TMEM168
Antibody Type: Monoclonal Antibody
HPA077143-100ul