Anti-LY6H

Catalog Number: ATA-HPA077218
Article Name: Anti-LY6H
Biozol Catalog Number: ATA-HPA077218
Supplier Catalog Number: HPA077218
Alternative Catalog Number: ATA-HPA077218-100,ATA-HPA077218-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NMLY6
Clonality: Polyclonal
Isotype: IgG
NCBI: 4062
UniProt: O94772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASS
Target: LY6H
Antibody Type: Monoclonal Antibody
HPA077218-100ul