Anti-SLC14A1
Catalog Number:
ATA-HPA077233
| Article Name: |
Anti-SLC14A1 |
| Biozol Catalog Number: |
ATA-HPA077233 |
| Supplier Catalog Number: |
HPA077233 |
| Alternative Catalog Number: |
ATA-HPA077233-100,ATA-HPA077233-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
HsT1341, JK, RACH1, RACH2 |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
6563 |
| UniProt: |
Q13336 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
MNGRSLIGGAGDARHGPVWKDPFGTKAGDAARRGIARLSLALADGSQEQE |
| Target: |
SLC14A1 |
| Antibody Type: |
Monoclonal Antibody |
![]()
|
HPA077233-100ul |
