Anti-ESRRA

Catalog Number: ATA-HPA077297
Article Name: Anti-ESRRA
Biozol Catalog Number: ATA-HPA077297
Supplier Catalog Number: HPA077297
Alternative Catalog Number: ATA-HPA077297-100,ATA-HPA077297-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ERR1, ERRa, ERRalpha, ESRL1, NR3B1
Clonality: Polyclonal
Isotype: IgG
NCBI: 2101
UniProt: P11474
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAAL
Target: ESRRA
Antibody Type: Monoclonal Antibody
HPA077297-100ul