Anti-NHLRC4

Catalog Number: ATA-HPA077301
Article Name: Anti-NHLRC4
Biozol Catalog Number: ATA-HPA077301
Supplier Catalog Number: HPA077301
Alternative Catalog Number: ATA-HPA077301-100,ATA-HPA077301-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 283948
UniProt: P0CG21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VGPGPDGGLAVSEEFGDVRLFGSARQPLGSLGGWTGHTFGCPAGICSNSEGNVIVVDEQ
Target: NHLRC4
Antibody Type: Monoclonal Antibody
HPA077301-100ul