Anti-ECEL1

Catalog Number: ATA-HPA077424
Article Name: Anti-ECEL1
Biozol Catalog Number: ATA-HPA077424
Supplier Catalog Number: HPA077424
Alternative Catalog Number: ATA-HPA077424-100,ATA-HPA077424-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DINE, XCE
Clonality: Polyclonal
Isotype: IgG
NCBI: 9427
UniProt: O95672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEDSEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQQLANITVSEHDDLR
Target: ECEL1
Antibody Type: Monoclonal Antibody
HPA077424-100ul