Anti-BSPRY

Catalog Number: ATA-HPA077485
Article Name: Anti-BSPRY
Biozol Catalog Number: ATA-HPA077485
Supplier Catalog Number: HPA077485
Alternative Catalog Number: ATA-HPA077485-100,ATA-HPA077485-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20150
Clonality: Polyclonal
Isotype: IgG
NCBI: 54836
UniProt: Q5W0U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEI
Target: BSPRY
Antibody Type: Monoclonal Antibody
HPA077485-100ul