Anti-MEFV

Catalog Number: ATA-HPA077497
Article Name: Anti-MEFV
Biozol Catalog Number: ATA-HPA077497
Supplier Catalog Number: HPA077497
Alternative Catalog Number: ATA-HPA077497-100,ATA-HPA077497-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FMF, MEF, TRIM20
Clonality: Polyclonal
Isotype: IgG
NCBI: 4210
UniProt: O15553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCE
Target: MEFV
Antibody Type: Monoclonal Antibody
HPA077497-100ul