Anti-HLA-DMB

Catalog Number: ATA-HPA077524
Article Name: Anti-HLA-DMB
Biozol Catalog Number: ATA-HPA077524
Supplier Catalog Number: HPA077524
Alternative Catalog Number: ATA-HPA077524-100,ATA-HPA077524-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: D6S221E, RING7
Clonality: Polyclonal
Isotype: IgG
NCBI: 3109
UniProt: P28068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL
Target: HLA-DMB
Antibody Type: Monoclonal Antibody
HPA077524-100ul