Anti-BORCS7

Catalog Number: ATA-HPA077528
Article Name: Anti-BORCS7
Biozol Catalog Number: ATA-HPA077528
Supplier Catalog Number: HPA077528
Alternative Catalog Number: ATA-HPA077528-100,ATA-HPA077528-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C10orf32, FLJ40752
Clonality: Polyclonal
Concentration: 0,05
NCBI: 119032
UniProt: Q96B45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK
Target: BORCS7
HPA077528-100ul