Anti-KCNH8

Catalog Number: ATA-HPA077537
Article Name: Anti-KCNH8
Biozol Catalog Number: ATA-HPA077537
Supplier Catalog Number: HPA077537
Alternative Catalog Number: ATA-HPA077537-100,ATA-HPA077537-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: elk3, Kv12.1
Clonality: Polyclonal
Isotype: IgG
NCBI: 131096
UniProt: Q96L42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SEVTTLTQEVSQLGKDMRNVIQLLENVLSPQQPSRFCSLHSTSVCPSRESLQTRTSWSAHQPCLHLQTGGAAYTQAQLCSSNITSDIWSVDPSSVGSSPQRTGAHEQNPADSELYHSPSLDYSPSHYQVVQEGHL
Target: KCNH8
Antibody Type: Monoclonal Antibody
HPA077537-100ul