Anti-ZNF594

Catalog Number: ATA-HPA077596
Article Name: Anti-ZNF594
Biozol Catalog Number: ATA-HPA077596
Supplier Catalog Number: HPA077596
Alternative Catalog Number: ATA-HPA077596-100,ATA-HPA077596-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1871
Clonality: Polyclonal
Isotype: IgG
NCBI: 84622
UniProt: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV
Target: ZNF594
Antibody Type: Monoclonal Antibody
HPA077596-100ul