Anti-BHLHE41

Catalog Number: ATA-HPA077617
Article Name: Anti-BHLHE41
Biozol Catalog Number: ATA-HPA077617
Supplier Catalog Number: HPA077617
Alternative Catalog Number: ATA-HPA077617-100,ATA-HPA077617-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BHLHB3, bHLHe41, DEC2, SHARP-1, SHARP1
Clonality: Polyclonal
Isotype: IgG
NCBI: 79365
UniProt: Q9C0J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
Target: BHLHE41
Antibody Type: Monoclonal Antibody
HPA077617-100ul