Anti-B4GALT5

Catalog Number: ATA-HPA077777
Article Name: Anti-B4GALT5
Biozol Catalog Number: ATA-HPA077777
Supplier Catalog Number: HPA077777
Alternative Catalog Number: ATA-HPA077777-100,ATA-HPA077777-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: beta4GalT-V
Clonality: Polyclonal
Concentration: 0,05
NCBI: 9334
UniProt: O43286
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY
Target: B4GALT5
HPA077777-100ul