Anti-ZNF469

Catalog Number: ATA-HPA077792
Article Name: Anti-ZNF469
Biozol Catalog Number: ATA-HPA077792
Supplier Catalog Number: HPA077792
Alternative Catalog Number: ATA-HPA077792-100,ATA-HPA077792-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1858, Zfp469
Clonality: Polyclonal
Concentration: 0,2
NCBI: 84627
UniProt: Q96JG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLCQAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSF
Target: ZNF469
HPA077792-100ul